Cagrilintide and CagriSema title beside two separate teal and mint translucent panels

What Is Cagrilintide? CagriSema, Weight Results and Side Effects

Cagrilintide / CagriSema

Cagrilintide is a long-acting amylin analogue studied for appetite and weight regulation. CagriSema combines cagrilintide with semaglutide; it is not another name for cagrilintide alone. Human studies have reported weight reductions, but the result depends on the material, population and comparison. Cagrilintide is not a GLP-1 agonist, and an investigational combination is not an approved research-vial treatment.

Does it work? Cagrilintide alone reduced average weight in a controlled phase 2 trial. The combination produced larger changes in several studies, but it did not meet every comparison against tirzepatide. A meaningful answer keeps monotherapy, CagriSema and the actual trial endpoint separate. Monotherapy trial · Pivotal combination trial

Cagrilintide versus CagriSema: what is the difference?

Cagrilintide

A modified amylin analogue, also called AM833. Its receptor pharmacology includes amylin and calcitonin receptors.

Semaglutide

A separate GLP-1 receptor agonist with a different structure and its own approved medicine formulations.

CagriSema = the two active substances in a defined clinical development programNot one new peptide sequence. Not either component alone.

The distinction determines which evidence applies. A result from cagrilintide monotherapy belongs to that material and study. A combination result cannot automatically be assigned to cagrilintide, semaglutide or a mixture prepared outside the trial. The formulation and delivery system also matter.

What is the Cagrilintide peptide?

Natural amylin is a pancreatic hormone released alongside insulin. Cagrilintide is an engineered, lipidated analogue developed for longer action. Its design addresses the practical challenge that natural amylin can form aggregates. Engineering stability does not make a peptide risk-free. Medicinal-chemistry development · Amylin research history

37 residues, with additional chemical features

KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

The backbone has a Cys2–Cys7 disulfide and a terminal amide. A lipid modification is attached through a linker; it is separate from the residue count. The reference formula C194H312N54O59S2 and approximate mass 4,409 Da describe cagrilintide, not a combined CagriSema molecule. PubChem reference

Amylin receptors are complexes: a calcitonin-receptor core pairs with a receptor-activity-modifying protein, or RAMP. The resulting receptor subtypes are related but not interchangeable. A 2025 structural study examined cagrilintide bound to these complexes and the calcitonin receptor itself. Receptor composition · Receptor structures

How is its action different from semaglutide?

Amylin-related signaling participates in fullness and nutrient handling; semaglutide activates the GLP-1 receptor. The reason to study them together is complementary biology, not an assumption that two peptides must always be better than one.

A 2026 cross-species brainstem study provides a useful example. In rats, reducing a prolactin-releasing-hormone signal in the dorsal vagal complex blocked cagrilintide’s measured effects but not semaglutide’s. Activating a different cell population did not change long-term food intake or weight. Receptor expression and an immediate cellular response therefore did not identify every effective long-term pathway. Cross-species atlas and rat perturbations

Another 2026 experimental study examined combined GLP-1 and calcitonin/amylin receptor activation within a particular brain region. It supports investigating complementary circuits; it is not a clinical trial of a self-prepared CagriSema blend or proof of universal synergy. Brain-region co-agonism study

Can Cagrilintide work on its own?

Yes, it has been studied as monotherapy. A 26-week phase 2 trial included 706 adults without diabetes across cagrilintide, liraglutide and placebo groups. It tested several assigned cagrilintide levels rather than one universal regimen. Read the trial

Cagrilintide alone · 26 weeks6.0–10.8%

Mean weight reductions across the five cagrilintide groups, versus 3.0% with placebo, under the trial-product analysis. The highest cagrilintide group also exceeded liraglutide’s 9.0% mean reduction in the prespecified comparison.

This is evidence of activity under the trial conditions. It is not a personal weight-loss prediction or a reason to use the most intensive study regimen. Gastrointestinal adverse events occurred in 41–63% of cagrilintide recipients across groups versus 32% with placebo.

How much weight did CagriSema trials report?

The large REDEFINE trials studied the combination over 68 weeks with lifestyle intervention. Diabetes status differed, so their headline percentages should not be blended into one expected result.

REDEFINE 13,417 participants
Without diabetes

−20.4% versus −3.0%

Estimated mean body-weight change with the combination versus placebo under the treatment-policy analysis. This analysis follows the randomized comparison while handling treatment discontinuation and other events according to the trial’s plan. 2025 primary report

REDEFINE 21,206 participants
With type 2 diabetes

−13.7% versus −3.4%

The corresponding 68-week treatment-policy comparison in a different population. These values do not show that a particular person will achieve either study’s average. 2025 primary report

REDEFINE 5 tested the combination against semaglutide in 331 participants in Japan and Taiwan, some with diabetes. At 68 weeks, the trial-product analysis estimated −18.4% versus −11.9% body-weight change. It adds a direct semaglutide comparison in that population; it should not be ranked against the treatment-policy percentages above as if the designs were identical. East Asian trial

Is Cagrilintide or CagriSema better than tirzepatide?

First identify the material: the head-to-head trials below tested CagriSema, not cagrilintide alone. They also asked different questions. “Non-inferiority” tests whether a treatment is not worse than its comparator beyond a prespecified margin; it is not the same as proving superiority.

REDEFINE 4 · Obesity · 84 weeks

Weight non-inferiority was not met

In the 809-person open-label trial, the developer reported 23.0% versus 25.5% mean weight loss under its efficacy analysis. The treatment-regimen values were 20.2% versus 23.6%, for CagriSema versus tirzepatide.

The large within-group changes did not reverse the failed primary comparison. These are the developer’s February 23, 2026 headline results. Primary announcement

REIMAGINE 4 · Type 2 diabetes · 68 weeks

Different verdicts for weight and HbA1c

The August 4, 2026 developer report says weight non-inferiority was met, but HbA1c non-inferiority was not. The reported adherent-treatment estimates were 15.2% versus 15.8% weight loss and 1.9 versus 2.2 percentage-point HbA1c reductions.

A weight result is not a blood-glucose result. This report concerns people receiving metformin with or without an SGLT2 inhibitor. Developer report, page 20

Both comparisons are sponsor-reported, open-label results, not evidence from a blinded comparison of cagrilintide alone. The exact-name PubMed search did not return a REIMAGINE 4 paper at the September 8, 2026 check; detailed peer-reviewed reporting may add context.

What else do the diabetes studies show?

The early combination program included a phase 1b safety and exposure study and a 92-person phase 2 diabetes trial. In the latter, weight change favored the combination over both components, but its primary HbA1c difference versus semaglutide was not statistically significant. That distinction is easy to lose when only the weight result is repeated. Phase 1b · Phase 2

The 2026 REIMAGINE publications cover three different settings:

  • REIMAGINE 1:189 people whose diabetes was inadequately controlled by diet and exercise; the combination improved the primary HbA1c endpoint versus placebo. Primary report
  • REIMAGINE 2:2,713 people receiving metformin with or without an SGLT2 inhibitor. The higher combination level improved HbA1c more than its matched semaglutide comparator under the efficacy analysis. Primary report
  • REIMAGINE 3:274 people receiving basal insulin with or without metformin; the combination improved HbA1c versus placebo. This is a supervised add-on study, not an instruction to combine a research peptide with insulin. Primary report

Why do different articles quote different weight-loss percentages?

What happened under the treatment plan?

A treatment-policy or treatment-regimen estimate addresses the randomized assignment with specified handling of events such as stopping treatment.

What if treatment were followed as intended?

A trial-product or efficacy estimate asks a more idealized question about continued assigned treatment under defined assumptions.

These labels need each trial’s actual definition. Neither lets a writer select the largest number and drop its conditions. Also distinguish a group’s change from baseline from the difference between groups. The formal trial objective can fail even when both groups lose substantial weight.

Cardiovascular benefit is a separate question. The REDEFINE 3 registry reported 7,101 actual participants, active follow-up and no posted results when checked on September 8, 2026. Its projected completion date is not a demonstrated heart-outcome benefit. Current cardiovascular-outcomes record

How long does Cagrilintide last in the body?

The phase 1b combination study reported a cagrilintide plasma half-life of 159–195 hours across its studied groups. That is roughly a week, but a plasma elimination estimate is not the duration of an individual’s appetite response, nor a personal dosing calendar. Original human pharmacokinetics

Two 2026 single-dose studies examined 33 participants grouped by kidney function and 32 grouped by liver function. They did not find clinically relevant exposure differences within those small studies. That does not establish long-term safety in every person with organ disease or validate unsupervised use. Renal and hepatic pharmacokinetic studies

What side effects and uncertainties matter?

Gastrointestinal symptoms—including nausea, vomiting, diarrhea and constipation—were prominent in the clinical program. In REDEFINE 1, gastrointestinal events were reported by 79.6% of combination recipients versus 39.9% with placebo. “Mostly mild or moderate” does not mean nobody had troublesome symptoms or stopped treatment. Trial safety results

The studies used specified materials, eligibility criteria, monitoring and background treatment. Most major compound-specific trials were funded by the developer. That does not invalidate their results, but it makes careful methods, full reporting and longer follow-up especially useful.

These sources do not define a safe self-directed cycle or a list of people for whom a research preparation is suitable. They also do not validate combining cagrilintide with tirzepatide or retatrutide. Such a mixture is not the semaglutide combination tested as CagriSema.

Is Cagrilintide or CagriSema FDA approved?

No FDA approval is established by the current sources checked on September 8, 2026. FDA’s current notice explicitly identifies cagrilintide as not being a component of an approved drug and states that it cannot be used in compounding under federal law. FDA notice

Novo Nordisk submitted a CagriSema application in December 2025. Its August 2026 report still described a future U.S. decision. An application, a projected decision date and a substance registry entry are not marketing authorization. Submission announcement · August update, page 21

What can a researcher learn from a product record?

Check exact molecular identity, material form, configuration and lot. A chromatographic-area percentage, a molecular identity result and a measured amount are separate observations. None establishes the manufacturing controls, delivery system, safety or clinical equivalence of an investigational finished medicine.

The Cagrilintide research product page is the place for offered material and applicable record links; this guide does not make a current-lot or universal-testing promise. See how to read a peptide COA for the reporting distinctions.

For adjacent questions, use the Semaglutide guide and next-generation GLP-1 research guide. Separate evidence for a component remains separate evidence.

Frequently Asked Questions

What is Cagrilintide?

Cagrilintide is a long-acting, modified amylin analogue studied for appetite and weight regulation. Its receptor biology differs from GLP-1 agonism. It is an investigational substance, not an approved treatment supplied by a research listing.

Is Cagrilintide the same as CagriSema?

No. CagriSema combines cagrilintide with semaglutide in a defined pharmaceutical development program. A monotherapy result and a combination result describe different interventions. CagriSema is not a single new peptide molecule.

Can Cagrilintide work without semaglutide?

A controlled 26-week trial studied cagrilintide alone and found greater mean weight reductions than placebo. The results differed across assigned groups and do not establish a personal regimen, a guaranteed outcome or equivalence to a research reagent.

Is CagriSema better than tirzepatide?

There is no single verdict across outcomes. In sponsor-reported REDEFINE 4, the weight non-inferiority objective was not met. In the separate REIMAGINE 4 diabetes trial, weight non-inferiority was met but HbA1c non-inferiority was not. Neither trial compared cagrilintide alone with tirzepatide.

What are the common side effects of Cagrilintide?

Gastrointestinal symptoms and administration-site reactions were common in the clinical studies. Findings belong to the materials and monitored populations studied. They do not establish that a research preparation is safe or suitable for a particular person.

How long does Cagrilintide stay in the body?

A phase 1b combination study reported a cagrilintide plasma half-life of 159 to 195 hours across studied groups. That estimate does not determine how long an individual feels an effect or provide a safe self-use schedule.

Is Cagrilintide FDA approved or available as compounded medicine?

At the September 8, 2026 check, FDA explicitly stated that cagrilintide is not a component of an approved drug and cannot be used in compounding under federal law. The developer had submitted a CagriSema application; submission is not approval.

Can Cagrilintide be combined with tirzepatide or retatrutide?

The trials reviewed here do not validate those self-directed combinations. CagriSema studies use semaglutide with cagrilintide in a specified clinical program. Replacing the partner or mixing research reagents creates a different intervention.

References and current source notes

These papers include mechanistic studies, early trials and distinct phase 3 populations. References are not a count of independent weight-loss replications. Sponsor announcements and current regulatory/registry records are linked beside the corresponding claims.

  1. Hay DL et al. Amylin receptors: molecular composition and pharmacology. Biochemical Society transactions. 2004. PMID 15494035.
  2. Lutz TA et al. Creating the amylin story. Appetite. 2022. PMID 35183619.
  3. Kruse T et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of medicinal chemistry. 2021. PMID 34288673.
  4. Cao J et al. Structural and dynamic features of cagrilintide binding to calcitonin and amylin receptors. Nature communications. 2025. PMID 40204768.
  5. Enebo LB et al. Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2·4 mg for weight management: a randomised, controlled, phase 1b trial. Lancet (London, England). 2021. PMID 33894838.
  6. Frias JP et al. Efficacy and safety of co-administered once-weekly cagrilintide 2·4 mg with once-weekly semaglutide 2·4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet (London, England). 2023. PMID 37364590.
  7. Garvey WT et al. Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity. The New England journal of medicine. 2025. PMID 40544433.
  8. Davies MJ et al. Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. The New England journal of medicine. 2025. PMID 40544432.
  9. Yamauchi T et al. Efficacy and safety of co-administered cagrilintide and semaglutide versus semaglutide alone in adults with overweight or obesity with or without type 2 diabetes in Japan and Taiwan (REDEFINE 5): a multicentre, randomised, active-controlled, phase 3a trial. The lancet. Diabetes & endocrinology. 2026. PMID 42009015.
  10. Aroda VR et al. Efficacy and safety of once-weekly cagrilintide-semaglutide (CagriSema) in adults with type 2 diabetes inadequately controlled on diet and exercise (REIMAGINE 1): a randomised, double-blind, placebo-controlled, phase 3a study. The lancet. Diabetes & endocrinology. 2026. PMID 42251860.
  11. Buse JB et al. Cagrilintide-semaglutide (CagriSema) versus semaglutide or cagrilintide in people with type 2 diabetes (REIMAGINE 2): a double-blind, randomised, controlled, phase 3 study. The lancet. Diabetes & endocrinology. 2026. PMID 42251859.
  12. Rosenstock J et al. Cagrilintide-semaglutide (CagriSema) as an add-on to basal insulin in adults with type 2 diabetes (REIMAGINE 3): a randomised, double-blind, placebo-controlled, multicentre, phase 3 study. Lancet (London, England). 2026. PMID 42251856.
  13. Lau DCW et al. Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. Lancet (London, England). 2021. PMID 34798060.
  14. Ludwig MQ et al. A cross-species atlas of the dorsal vagal complex reveals neural mediators of the effects of cagrilintide on energy balance. Nature metabolism. 2026. PMID 42260119.
  15. Sanchez-Navarro MJ et al. Co-agonism of GLP-1R and CTR/AMYR in the lateral dorsal tegmental nucleus produces additive effects on homeostatic and motivated feeding. Physiology & behavior. 2026. PMID 42603595.
  16. Nielsen MJF et al. Renal or Hepatic Impairment Does Not Affect Pharmacokinetics, Safety, or Tolerability of Subcutaneous Cagrilintide. Clinical pharmacokinetics. 2026. PMID 42228334.