Certificate of analysis · Apex Laboratory
LL-37 5 mg
APX-2026-0704-L
For laboratory research use only. The issue date identifies this certificate; it is not a testing date.
Preview report pages Analytical record
Results & specifications
T01Identity and structure
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Orthogonal identity against specified referenceHuman cathelicidin LL-37: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH,37 residues, all chiral residues L; unblocked N-terminus and C-terminal acid. | Conforms to the assigned reference; see identity basisPASS | Conforms to the specified acceptance criterion | M-T01-DEFAULT |
Supporting analytical detail for Orthogonal identity against specified reference
| |||
| Orthogonal fingerprint similarityspectrum/peptide-map comparison; score is not proof of stereochemistry | 0.9994 similarity (0-1)PASS | >= 0.995similarity (0-1) | M-T01-DEFAULT |
Supporting analytical detail for Orthogonal fingerprint similarity
| |||
| LL-37 5 mg HRMS ion mass error[M+3H]^3+; reference monoisotopic M=4490.5754259 Da; molecule excludes associated salt/solvate | -0.4505 ppmPASS | -5 to 5ppm | M-T01-DEFAULT |
Supporting analytical detail for LL-37 5 mg HRMS ion mass error
| |||
| LL-37 5 mg: Phe D fractionResidue-specific target from explicit structure. Mixed D/L ratios are intentional where stated; not total chemical-purity percentage. | 0.02 mol% of selected amino acidPASS | 0 to 0.1mol% of selected amino acid | M-T01-RESIDUE-CHIRAL-LC |
Supporting analytical detail for LL-37 5 mg: Phe D fraction
| |||
T02Chromatographic purity
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| LL-37 5 mg chromatographic puritySingle analyte method scope; intended blend co-components and excipients excluded by analyte-specific selectivity, not denominator manipulation | 99.901 % integrated detector areaPASS | 99.7 to 100% integrated detector area | M-T02-RP-UPLC-DAD |
Supporting analytical detail for LL-37 5 mg chromatographic purity
| |||
T05Related substances and degradants
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| LL-37 5 mg Unknown U1Same analyte-specific chromatogram as T02; response factor assumed 1.00 for unknowns; area only | 0.05 % integrated detector areaPASS | <= 0.1% integrated detector area | M-T05-DEFAULT |
Supporting analytical detail for LL-37 5 mg Unknown U1
| |||
| LL-37 5 mg Unknown U2Same analyte-specific chromatogram as T02; response factor assumed 1.00 for unknowns; area only | 0.03 % integrated detector areaPASS | <= 0.1% integrated detector area | M-T05-DEFAULT |
Supporting analytical detail for LL-37 5 mg Unknown U2
| |||
| LL-37 5 mg Unknown U3Same analyte-specific chromatogram as T02; response factor assumed 1.00 for unknowns; area only | 0.019 % integrated detector areaPASS | <= 0.1% integrated detector area | M-T05-DEFAULT |
Supporting analytical detail for LL-37 5 mg Unknown U3
| |||
| LL-37 5 mg total related peaksSum of U1+U2+U3; purity plus related areas = 100% | 0.099 % integrated detector areaPASS | <= 0.3% integrated detector area | M-T05-DEFAULT |
Supporting analytical detail for LL-37 5 mg total related peaks
| |||
T03Active content and assay
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| LL-37 5 mg active contentAssigned component material basis; excludes vehicle/excipient/water; salt basis explicitly in identity specification | 5.00025 mg/vialPASS | 4.9 to 5.1mg/vial | M-T03-DEFAULT |
Supporting analytical detail for LL-37 5 mg active content
| |||
| LL-37 5 mg label claim assayIndependent calibrated amount / nominal amount x 100; not chromatographic area purity | 100.005 % label claimPASS | 98 to 102% label claim | M-T03-DEFAULT |
Supporting analytical detail for LL-37 5 mg label claim assay
| |||
T15Unit uniformity
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| LL-37 5 mg individual-unit meanspecified sample/form only | 100.005 % label claimPASS | 98 to 102% label claim | M-T15-DEFAULT |
Supporting analytical detail for LL-37 5 mg individual-unit mean
| |||
| LL-37 5 mg acceptance value (n=10)AV=abs(M-mean)+2.4 sample SD; target 100%; M=mean within 98.5-101.5 | 0.8458 % label claimPASS | <= 15% label claim | M-T15-DEFAULT |
Supporting analytical detail for LL-37 5 mg acceptance value (n=10)
| |||
| LL-37 5 mg individual-unit RSDPrecision criterion for the listed specification, independently of AV | 0.3524 %PASS | <= 2% | M-T15-DEFAULT |
Supporting analytical detail for LL-37 5 mg individual-unit RSD
| |||
T04Blend composition
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Applicability decisionspecified sample/form only | Not applicable — One declared active or a water/preservative reagent. Preservative is separately quantified under T14; there is no multi-active blend ratio.N/A — justified | Not applicable — One declared active or a water/preservative reagent. Preservative is separately quantified under T14; there is no multi-active blend ratio. | M-T04-DEFAULT |
Supporting analytical detail for Applicability decision
| |||
T06Water content
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Residual waterWater as percentage of total net formulation, not peptide area purity | 0.832 % w/w finished fillPASS | <= 2% w/w finished fill | M-T06-KF |
Supporting analytical detail for Residual water
| |||
T07Counterions and associated species
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Acetate content relative to parent active massExplicit process/counterion basis; acetate-associated material. No fixed stoichiometric salt is asserted; acidic peptides may contain residual process acetate rather than a counterion. | 1.5 % acetate/parent massPASS | 0.5 to 3% acetate/parent mass | M-T07-DEFAULT |
Supporting analytical detail for Acetate content relative to parent active mass
| |||
T08Residual solvents
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| MethanolMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 19.033 ug/g finished fillPASS | <= 3000ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Methanol
| |||
| AcetonitrileMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 8.088 ug/g finished fillPASS | <= 410ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Acetonitrile
| |||
| DichloromethaneMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 3.615 ug/g finished fillPASS | <= 600ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Dichloromethane
| |||
| N, N-dimethylformamideMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 3.815 ug/g finished fillPASS | <= 880ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for N, N-dimethylformamide
| |||
| EthanolMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 38.636 ug/g finished fillPASS | <= 5000ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Ethanol
| |||
| AcetoneMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 11.037 ug/g finished fillPASS | <= 5000ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Acetone
| |||
| Ethyl acetateMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 9.276 ug/g finished fillPASS | <= 5000ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Ethyl acetate
| |||
| TolueneMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 1.828 ug/g finished fillPASS | <= 890ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Toluene
| |||
| n-HexaneMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 1.102 ug/g finished fillPASS | <= 290ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for n-Hexane
| |||
| BenzeneMaterial-based limit. Liquid numerical limits are listed specification and not ICH Option1 mass ppm. | 0.074 ug/g finished fillPASS | <= 2ug/g finished fill | M-T08-DEFAULT |
Supporting analytical detail for Benzene
| |||
T09Elemental impurities
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| LeadTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0118 ug/g finished fillPASS | <= 0.5ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Lead
| |||
| CadmiumTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0074 ug/g finished fillPASS | <= 0.2ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Cadmium
| |||
| ArsenicTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0182 ug/g finished fillPASS | <= 0.5ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Arsenic
| |||
| MercuryTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0062 ug/g finished fillPASS | <= 0.1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Mercury
| |||
| CobaltTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0237 ug/g finished fillPASS | <= 1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Cobalt
| |||
| VanadiumTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.022 ug/g finished fillPASS | <= 1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Vanadium
| |||
| NickelTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0352 ug/g finished fillPASS | <= 2ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Nickel
| |||
| PalladiumTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0106 ug/g finished fillPASS | <= 1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Palladium
| |||
| PlatinumTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0087 ug/g finished fillPASS | <= 1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Platinum
| |||
| RhodiumTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0072 ug/g finished fillPASS | <= 1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Rhodium
| |||
| RutheniumTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0096 ug/g finished fillPASS | <= 1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Ruthenium
| |||
| IridiumTotal element; no speciation. material-based criterion, not a dose/route-derived safety limit. | 0.0055 ug/g finished fillPASS | <= 1ug/g finished fill | M-T09-DEFAULT |
Supporting analytical detail for Iridium
| |||
T13pH and analytical solution
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| pH of specified buffered analytical solution1.000 mg active/mL in 25mM acetate buffer, pH4.80,25.0C; buffer-solution compatibility is not the pH of dry material | 4.84 pHPASS | 4.1 to 5.5pH | M-T13-DEFAULT |
Supporting analytical detail for pH of specified buffered analytical solution
| |||
T14Excipients and preservatives
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Trehalose contentSeparate excipient-specific assay; not label active | 5.004 mg/vialPASS | 4.75 to 5.25mg/vial | M-T14-DEFAULT |
Supporting analytical detail for Trehalose content
| |||
T21Appearance and physical inspection
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| AppearanceThree containers under diffuse white illumination | white to off-white; uniform lyophilized cakePASS | Conforms to the specified acceptance criterion | M-T21-DEFAULT |
Supporting analytical detail for Appearance
| |||
| Visible foreign matterVisual observation only; subvisible particles reported separately | None observed in 3 inspected unitsPASS | Conforms to the specified acceptance criterion | M-T21-DEFAULT |
Supporting analytical detail for Visible foreign matter
| |||
T10Sterility test
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Sterility: FTMFTM30-35C; tested units only; growth-promotion/suitability controls conform | No growth at 14 days in all 20 unitsPASS | Conforms to the specified acceptance criterion | M-T10-DEFAULT |
Supporting analytical detail for Sterility: FTM
| |||
| Sterility: SCDMSCDM20-25C; tested units only; no sterility assurance level assigned | No growth at 14 days in all 20 unitsPASS | Conforms to the specified acceptance criterion | M-T10-DEFAULT |
Supporting analytical detail for Sterility: SCDM
| |||
T11Bacterial endotoxins
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Bacterial endotoxinsSample reporting limit after1:5 dilution; threshold is and not based on administration route/dose | <0.025 EU/mg active-equivalentPASS | <= 0.1EU/mg active-equivalent | M-T11-DEFAULT |
Supporting analytical detail for Bacterial endotoxins
| |||
T12Microbial enumeration
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| TAMCZero colonies observed from1g or1 mL equivalent filter; report <1, not exact absence | <1 CFU/g finished fillPASS | <= 100CFU/g finished fill | M-T12-DEFAULT |
Supporting analytical detail for TAMC
| |||
| TYMCZero colonies observed from1g or1 mL equivalent filter; report <1, not exact absence | <1 CFU/g finished fillPASS | <= 10CFU/g finished fill | M-T12-DEFAULT |
Supporting analytical detail for TYMC
| |||
| Escherichia coliSpecified-organism enrichment in explicit1g/1 mL scope; not a universal pharmacopeial panel | Not detected in 1gPASS | Conforms to the specified acceptance criterion | M-T12-DEFAULT |
Supporting analytical detail for Escherichia coli
| |||
| Staphylococcus aureusSpecified-organism enrichment in explicit1g/1 mL scope; not a universal pharmacopeial panel | Not detected in 1gPASS | Conforms to the specified acceptance criterion | M-T12-DEFAULT |
Supporting analytical detail for Staphylococcus aureus
| |||
| Pseudomonas aeruginosaSpecified-organism enrichment in explicit1g/1 mL scope; not a universal pharmacopeial panel | Not detected in 1gPASS | Conforms to the specified acceptance criterion | M-T12-DEFAULT |
Supporting analytical detail for Pseudomonas aeruginosa
| |||
| Salmonella speciesSpecified-organism enrichment in explicit1g/1 mL scope; not a universal pharmacopeial panel | Not detected in 1gPASS | Conforms to the specified acceptance criterion | M-T12-DEFAULT |
Supporting analytical detail for Salmonella species
| |||
| Candida albicansSpecified-organism enrichment in explicit1g/1 mL scope; not a universal pharmacopeial panel | Not detected in 1gPASS | Conforms to the specified acceptance criterion | M-T12-DEFAULT |
Supporting analytical detail for Candida albicans
| |||
T16Biological activity
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Applicability decisionspecified sample/form only | Not applicable — No qualified, reference-traceable potency endpoint is established for this selected identity. Identity/content data cannot justify an invented biological potency value; exploratory biological activity would require a separately defined assay.N/A — justified | Not applicable — No qualified, reference-traceable potency endpoint is established for this selected identity. Identity/content data cannot justify an invented biological potency value; exploratory biological activity would require a separately defined assay. | M-T16-DEFAULT |
Supporting analytical detail for Applicability decision
| |||
T17Protein and conjugate characterization
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Applicability decisionspecified sample/form only | Not applicable — No recombinant protein, polymer conjugate or complex mixture for this material. Defined synthetic peptide identity is characterized under T01; GHK copper speciation, when relevant, is explicit.N/A — justified | Not applicable — No recombinant protein, polymer conjugate or complex mixture for this material. Defined synthetic peptide identity is characterized under T01; GHK copper speciation, when relevant, is explicit. | M-T17-DEFAULT |
Supporting analytical detail for Applicability decision
| |||
T18Process impurities
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Applicability decisionspecified sample/form only | Not applicable — chemical synthesis without cell/tissue manufacturing inputs; HCP, host DNA and Protein A are not relevant. Chemical process impurities are covered under T05/T08/T09.N/A — justified | Not applicable — chemical synthesis without cell/tissue manufacturing inputs; HCP, host DNA and Protein A are not relevant. Chemical process impurities are covered under T05/T08/T09. | M-T18-DEFAULT |
Supporting analytical detail for Applicability decision
| |||
T19Particles and container closure
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Subvisible particles >= 10umAs-supplied liquid or entire dry vial dissolved to stated analytical volume; limits, no injectable compliance claim | 21 particles/containerPASS | <= 6000particles/container | M-T19-DEFAULT |
Supporting analytical detail for Subvisible particles >= 10um
| |||
| Subvisible particles >= 25umAs-supplied liquid or entire dry vial dissolved to stated analytical volume; limits, no injectable compliance claim | 2 particles/containerPASS | <= 600particles/container | M-T19-DEFAULT |
Supporting analytical detail for Subvisible particles >= 25um
| |||
| Vacuum decay package integritymethod vacuum-decay threshold0.20kPa/60s;5um positive defect control. No universal leakage-to-sterility equivalence. | 10/10test closures conform; positive-leak controls detectedPASS | Conforms to the specified acceptance criterion | M-T19-DEFAULT |
Supporting analytical detail for Vacuum decay package integrity
| |||
T20Stability observations
| Test / endpoint | Result | Acceptance criterion | Method |
|---|---|---|---|
| Reported 6 month assay retentionReported change relative to the initial assay. This report does not assign a retest date or shelf life. | 99.91 % of initial assayPASS | 98 to 102% of initial assay | M-T20-DEFAULT |
Supporting analytical detail for Reported 6 month assay retention
| |||
| Reported 6 month minimum component puritySeparate endpoint; no shelf-life claim | 99.859 % integrated detector areaPASS | 99.7 to 100% integrated detector area | M-T20-DEFAULT |
Supporting analytical detail for Reported 6 month minimum component purity
| |||
| Dating dispositionReported change relative to the initial assay. This report does not assign a retest date or shelf life. | 6 month review point; actual expiry/retest not assignedPASS | Conforms to the specified acceptance criterion | M-T20-DEFAULT |
Supporting analytical detail for Dating disposition
| |||
Method references
How the results are documented
- M-T01-DEFAULT
- Orthogonal chemical/structural identityLC-HRMS/MS plus sequence/connectivity-sensitive reference comparison
- M-T02-RP-UPLC-DAD
- Component-specific reversed-phase chromatographic response purityRP-UPLC with diode-array detection
- M-T05-DEFAULT
- Related substancesStability-indicating LC integration; orthogonal size/charge separation for biologics
- M-T03-DEFAULT
- Calibrated material contentIndependent quantitative LC/CAD, protein assay or bioactivity calibration for IU
- M-T15-DEFAULT
- Individual-unit uniformityTen separate unit preparations and fill measurements
- M-T04-DEFAULT
- Component-resolved blend assaySeparate calibrated selective assay for every declared component
- M-T06-KF
- Residual formulation water on a defined mass basisCoulometric Karl Fischer with oven transfer
- M-T07-DEFAULT
- Counterion compositionIon chromatography and stoichiometric accounting
- M-T08-DEFAULT
- Residual solvent panelheadspace GC-MS
- M-T09-DEFAULT
- Elemental impurity panelICP-MS
- M-T13-DEFAULT
- pH and solution stateCalibrated potentiometry
- M-T14-DEFAULT
- Excipients/preservativesComponent-specific quantitative LC/CAD or formulation identity
- M-T21-DEFAULT
- AppearanceControlled visual examination
- M-T10-DEFAULT
- Sterility observations in two media with matrix-specific preparationMembrane filtration/rinsing or neutralized direct inoculation for Lemon dispersion
- M-T11-DEFAULT
- Bacterial endotoxinsRecombinant factor C fluorometric assay
- M-T12-DEFAULT
- Microbial enumeration/organismsMembrane filtration enumeration and enrichment
- M-T16-DEFAULT
- Functional biological activityReference-relative concentration-response assay
- M-T17-DEFAULT
- Protein/conjugate characterizationSEC-MALS, CE-SDS, peptide mapping, glycan/PEG profiling
- M-T18-DEFAULT
- Biological process impurity panelHost/process-specific ELISA and qPCR
- M-T01-RESIDUE-CHIRAL-LC
- Diagnostic amino-acid absolute-configuration/composition checkMarfey-type diastereomeric derivatization LC-MS with authentic L/D references
- M-T19-DEFAULT
- Particles and package integrityLight obscuration plus vacuum decay
- M-T20-DEFAULT
- Stability observationTime-zero/1/3/6-month trend
Apex Laboratory issues this certificate. Results apply to the stated configuration and lot. Browse all certificates.